PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G438900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 242aa    MW: 27958.8 Da    PI: 6.6385
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G438900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.2e-082166346
                       SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        WT   d+l+ +a   ++ +   +W +Ia++++ g+t+ ++k ++ +
  Aqcoe1G438900.1.p 21 TWTRVQDKLFEQALVIFPEEtndRWQKIASEVP-GKTAWEVKQHYED 66
                       7*****************99*************.***********76 PP

2Myb_DNA-binding44.63.3e-14126170347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE++l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
  Aqcoe1G438900.1.p 126 PWTEEEHKLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 170
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7711468IPR017877Myb-like domain
SMARTSM007179.0E-101870IPR001005SANT/Myb domain
SuperFamilySSF466892.44E-122076IPR009057Homeodomain-like
PfamPF002499.3E-72167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-42169IPR009057Homeodomain-like
CDDcd001672.17E-72168No hitNo description
PROSITE profilePS5129418.684119175IPR017930Myb domain
SuperFamilySSF466891.45E-16121176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-16122173IPR006447Myb domain, plants
SMARTSM007171.8E-10123173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-12123169IPR009057Homeodomain-like
CDDcd001671.19E-8126170No hitNo description
PfamPF002497.0E-12126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLQDNNSLWM IGGNSSNSNS TWTRVQDKLF EQALVIFPEE TNDRWQKIAS EVPGKTAWEV  60
KQHYEDLVRD VLEIDNGRVR LPCYTDDSFD DDEMNWDSDQ SKQKSQISFS STKSKHSESE  120
RKKGTPWTEE EHKLFLIGLQ KYGKGDWRSI SRNAVVSRTP TQVASHAQKY YLRLNSGKKE  180
KRRSSIHDIT TVENDSVSEV NNHFLEQQFH NPVWKTVQTV KPTISYPSQA GSSGYQQQYE  240
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-131384273RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245815.18e-93PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4U9T92e-83V4U9T9_9R
STRINGVIT_06s0080g00790.t019e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-60MYB family protein